Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Krueppel-like factor 11 |
|---|
Gene and Protein Information
| Gene ID | 8462 |
|---|---|
| Uniprot Accession IDs | O14901 B4DZE7 Q9EPF4 |
| Ensembl ID | ENSP00000307023 |
| Symbol | FKLF TIEG2 FKLF FKLF1 MODY7 TIEG2 Tieg3 |
| Family | Belongs to the Sp1 C2H2-type zinc-finger protein family. |
| Sequence | MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTRTPVSPQVTDSKACTATDVLQSSAVVARALSGGAERGLLGLEPVPSSPCRAKGTSVIRHTGESPAACFPTIQTPDCRLSDSREGEEQLLGHFETLQDTHLTDSLLSTNLVSCQPCLHKSGGLLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSVPAPPVLCQMIPVTGQSSMLPAFLKPPPQLSVGTVRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALPPPAPCAANVMAAGNTKLLPLAPAPVFITSSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459023 | KLF11 | Kruppel like factor 11 | 9598 | VGNC:48967 | OMA, EggNOG |
| Macaque | 702323 | KLF11 | Kruppel like factor 11 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 194655 | Klf11 | Kruppel-like factor 11 | 10090 | MGI:2653368 | Inparanoid, OMA, EggNOG |
| Rat | 313994 | Klf11 | Kruppel-like factor 11 | 10116 | RGD:1306646 | Inparanoid, OMA |
| Dog | 475665 | KLF11 | Kruppel like factor 11 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100072433 | KLF11 | Kruppel like factor 11 | 9796 | VGNC:19441 | Inparanoid, OMA, EggNOG |
| Cow | 616730 | KLF11 | Kruppel like factor 11 | 9913 | VGNC:52789 | Inparanoid, OMA, EggNOG |
| Opossum | 100031998 | KLF11 | Kruppel like factor 11 | 13616 | Inparanoid, EggNOG | |
| Platypus | 100076715 | KLF11 | Kruppel like factor 11 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 421934 | KLF11 | Kruppel like factor 11 | 9031 | CGNC:51568 | Inparanoid, OMA |
| Anole lizard | 100563320 | klf11 | Kruppel like factor 11 | 28377 | Inparanoid, OMA | |
| Xenopus | 733909 | klf11 | Kruppel-like factor 11 | 8364 | XB-GENE-956858 | Inparanoid, OMA |
| Zebrafish | 560787 | klf11a | Kruppel-like factor 11a | 7955 | ZDB-GENE-030131-3568 | Inparanoid, OMA |
| Zebrafish | 559076 | klf11b | Kruppel-like factor 11b | 7955 | ZDB-GENE-061103-82 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Krueppel-like factor 11
protein / nucleic acid binding / transcription cofactor / Krueppel-like factor 11
protein / nucleic acid binding / zinc finger transcription factor / Krueppel-like factor 11
protein / nucleic acid binding / DNA binding protein / Krueppel-like factor 11
protein / nucleic acid binding / transcription cofactor / Krueppel-like factor 11
protein / nucleic acid binding / zinc finger transcription factor / Krueppel-like factor 11
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.