224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Hepcidin |
|---|
Gene and Protein Information
| Gene ID | 57817 |
|---|---|
| Uniprot Accession IDs | P81172 Q1HE14 Q9BY68 |
| Ensembl ID | ENSP00000471894 |
| Symbol | HEPC LEAP1 HEPC PLTR HFE2B LEAP1 |
| Family | Belongs to the hepcidin family. |
| Sequence | MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 744861 | HAMP | hepcidin antimicrobial peptide | 9598 | VGNC:2552 | Inparanoid, OMA, EggNOG |
| Macaque | 708397 | HAMP | hepcidin antimicrobial peptide | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 66438 | Hamp2 | hepcidin antimicrobial peptide 2 | 10090 | MGI:2153530 | Inparanoid, OMA, EggNOG |
| Rat | 84604 | Hamp | hepcidin antimicrobial peptide | 10116 | RGD:70971 | Inparanoid, OMA |
| Dog | 492281 | HAMP | hepcidin antimicrobial peptide | 9615 | VGNC:41588 | Inparanoid, OMA, EggNOG |
| Cow | 512301 | HAMP | hepcidin antimicrobial peptide | 9913 | VGNC:29745 | Inparanoid, OMA, EggNOG |
| Opossum | 103099012 | HAMP | hepcidin antimicrobial peptide | 13616 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.