224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Serine protease hepsin |
|---|
Gene and Protein Information
| Gene ID | 3249 |
|---|---|
| Uniprot Accession IDs | P05981 B2RDS4 |
| Ensembl ID | ENSP00000262626 |
| Symbol | TMPRSS1 TMPRSS1 |
| Family | Belongs to the peptidase S1 family. |
| Sequence | MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 455944 | HPN | hepsin | 9598 | VGNC:2354 | OMA, EggNOG |
| Macaque | 707242 | HPN | hepsin | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 15451 | Hpn | hepsin | 10090 | MGI:1196620 | Inparanoid, EggNOG |
| Rat | 29135 | Hpn | hepsin | 10116 | RGD:61982 | Inparanoid, OMA, EggNOG |
| Dog | 484583 | HPN | hepsin | 9615 | VGNC:41772 | Inparanoid, OMA, EggNOG |
| Horse | 100058873 | HPN | hepsin | 9796 | VGNC:18859 | Inparanoid, OMA, EggNOG |
| Cow | 508148 | HPN | hepsin | 9913 | VGNC:29942 | Inparanoid, OMA, EggNOG |
| Opossum | 100015125 | HPN | hepsin | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100553659 | hpn | hepsin | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100145343 | hpn | hepsin | 8364 | XB-GENE-995348 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.