Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | FXYD domain-containing ion transport regulator 5 |
|---|
Gene and Protein Information
| Gene ID | 53827 |
|---|---|
| Uniprot Accession IDs | Q96DB9 B7WNZ8 Q6UW44 Q9HC34 Q9P039 |
| Ensembl ID | ENSP00000344254 |
| Symbol | DYSAD IWU1 RIC IWU1 KCT1 OIT2 DYSAD HSPC113 PRO6241 |
| Family | Belongs to the FXYD family. |
| Sequence | MSPSGRLCLLTIVGLILPTRGQTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITGIIILTSGKCRQLSRLCRNRCR |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 744650 | FXYD5 | FXYD domain containing ion transport regulator 5 | 9598 | VGNC:3633 | OMA, EggNOG |
| Macaque | 718467 | FXYD5 | FXYD domain containing ion transport regulator 5 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18301 | Fxyd5 | FXYD domain-containing ion transport regulator 5 | 10090 | MGI:1201785 | Inparanoid, OMA, EggNOG |
| Rat | 60338 | Fxyd5 | FXYD domain-containing ion transport regulator 5 | 10116 | RGD:620827 | Inparanoid, OMA, EggNOG |
| Dog | 612666 | FXYD5 | FXYD domain containing ion transport regulator 5 | 9615 | VGNC:41023 | Inparanoid, OMA, EggNOG |
| Horse | 100059073 | FXYD5 | FXYD domain containing ion transport regulator 5 | 9796 | VGNC:18165 | Inparanoid, OMA, EggNOG |
| Cow | 505584 | FXYD5 | FXYD domain containing ion transport regulator 5 | 9913 | VGNC:29158 | Inparanoid, OMA, EggNOG |
| Pig | 100624274 | FXYD5 | FXYD domain containing ion transport regulator 5 | 9823 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transporter / ion channel / FXYD domain-containing ion transport regulator 5
protein / transporter / enzyme modulator / FXYD domain-containing ion transport regulator 5
protein / transporter / ion channel / FXYD domain-containing ion transport regulator 5
protein / transporter / enzyme modulator / FXYD domain-containing ion transport regulator 5
DTO Classes
protein / Ion channel / Phospholemman (plm) family / FXYD domain-containing ion transport regulator 5
protein / Ion channel / Phospholemman (plm) family / FXYD domain-containing ion transport regulator 5
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.