224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Low affinity immunoglobulin gamma Fc region receptor II-a |
|---|
Gene and Protein Information
| Gene ID | 2212 |
|---|---|
| Uniprot Accession IDs | P12318 Q8WUN1 Q8WW64 IgG Fc receptor II-a |
| Ensembl ID | ENSP00000271450 |
| Symbol | CD32 FCG2 FCGR2A1 IGFR2 CD32 FCG2 FcGR CD32A CDw32 FCGR2 IGFR2 FCGR2A1 |
| Sequence | MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450194 | FCGR2A | Fc fragment of IgG receptor IIa | 9598 | VGNC:11433 | Inparanoid, OMA, EggNOG |
| Dog | 100856270 | LOC100856270 | low affinity immunoglobulin gamma Fc region receptor II | 9615 | Inparanoid, OMA | |
| Pig | 613131 | FCGR2B | Fc fragment of IgG, low affinity IIb, receptor (CD32) | 9823 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.