The store will not work correctly when cookies are disabled.
Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
FKBP1B Descripción Peptidyl-prolyl cis-trans isomerase FKBP1B
Gene and Protein Information Gene ID 2281 Uniprot Accession IDs P68106 Q13664 Q16645 Q53TM2 Q9BQ40 PPIase FKBP1B Ensembl ID ENSP00000370373 Symbol FKBP12.6 FKBP1L FKBP9 OTK4 OTK4 FKBP1L PKBP1L PPIase FKBP12.6 Family Belongs to the FKBP-type PPIase family. FKBP1 subfamily. Sequence MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Homologous gene and protein info.
Species Gene ID Gene Symbol Nombre NIF Other Gene ID Sources Chimp 741549 FKBP1B FK506 binding protein 1B 9598 VGNC:10650 OMA, EggNOG Mouse 14226 Fkbp1b FK506 binding protein 1b 10090 MGI:1336205 Inparanoid, OMA, EggNOG Rat 58950 Fkbp1b FK506 binding protein 1B 10116 RGD:61835 Inparanoid, OMA, EggNOG Dog 612965 FKBP1B FK506 binding protein 1B 9615 VGNC:54305 Inparanoid, OMA, EggNOG Horse 100071629 FKBP1B FK506 binding protein 1B 9796 VGNC:51312 Inparanoid, OMA, EggNOG Cow 785179 FKBP1B FK506 binding protein 1B 9913 VGNC:29021 Inparanoid, OMA, EggNOG Opossum 100014696 FKBP1B FK506 binding protein 1B 13616 Inparanoid, OMA, EggNOG Anole lizard 100565880 fkbp1b FK506 binding protein 1B 28377 Inparanoid, OMA Zebrafish 393785 fkbp1b FK506 binding protein 1b 7955 ZDB-GENE-040426-1785 Inparanoid, OMA C. elegans 173160 fkb-2 Peptidylprolyl isomerase 6239 Inparanoid, OMA S.cerevisiae 855587 FPR1 peptidylprolyl isomerase FPR1 4932 S000005079 Inparanoid, OMA
Associated Recombinant Proteins Nombre Specification and purity Expression system Protein label Disponibilidad Mostrar detalles
Associated Antibodies
Nombre Specifications Species reactivity Aplicación Disponibilidad Mostrar detalles
Associated Approved Drugs Associated Active Ligands Associated Diseases Nombre Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Configuración Aceptar todo Rechazar
Shall we send you a message when we have discounts available?
Remind me later Permitir
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.