🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

FZD6

DescripciónFrizzled-6

Gene and Protein Information

Gene ID8323
Uniprot Accession IDs O60353 B4DRN0 Q6N0A5 Q6P9C3 Q8WXR9 Fz-6
Ensembl ID ENSP00000351605
Symbol FZ6 FZ-6 HFZ6 NDNC10
FamilyBelongs to the G-protein coupled receptor Fz/Smo family.
Sequence
MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECSPNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp464327FZD6frizzled class receptor 69598VGNC:869OMA, EggNOG
Macaque694625FZD6frizzled class receptor 69544Inparanoid, OMA, EggNOG
Mouse14368Fzd6frizzled class receptor 610090MGI:108474Inparanoid, OMA, EggNOG
Rat282581Fzd6frizzled class receptor 610116RGD:628816Inparanoid, OMA, EggNOG
Dog403610FZD6frizzled class receptor 69615VGNC:41034Inparanoid, OMA, EggNOG
Horse100056351FZD6frizzled class receptor 69796VGNC:18174Inparanoid, OMA, EggNOG
Cow445418FZD6frizzled class receptor 69913VGNC:29170Inparanoid, OMA, EggNOG
Pig100157360FZD6frizzled class receptor 69823OMA, EggNOG
Opossum100023959FZD6frizzled class receptor 613616Inparanoid, OMA, EggNOG
PlatypusFZD6frizzled class receptor 6 [Source:HGNC Symbol;Acc:HGNC:4044]9258OMA, EggNOG
Anole lizard100565631fzd6frizzled class receptor 628377Inparanoid, OMA
Xenopus100490861fzd6frizzled class receptor 68364XB-GENE-478813Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    protease inhibitor    /    Frizzled-6
protein    /    receptor    /    signaling molecule    /    Frizzled-6
protein    /    receptor    /    G-protein coupled receptor    /    Frizzled-6
DTO Classes
protein    /    G-protein coupled receptor    /    Class F frizzled-type    /    Frizzled receptor    /    Frizzled-6

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.