🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

FNDC5

DescripciónFibronectin type III domain-containing protein 5

Gene and Protein Information

Gene ID252995
Uniprot Accession IDs Q8NAU1 A6NMC9 D3DPQ6 Q6P6D9 Q7Z676
Ensembl ID ENSP00000362570
Symbol FRCP2 FRCP2 irisin
Sequence
MHPGSPSAWPPRARAALRLWLGCVCFALVQADSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGLLRSKI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp746970FNDC5fibronectin type III domain containing 59598VGNC:10645OMA, EggNOG
Mouse384061Fndc5fibronectin type III domain containing 510090MGI:1917614Inparanoid, OMA, EggNOG
Rat260327Fndc5fibronectin type III domain containing 510116RGD:708525Inparanoid, OMA, EggNOG
Dog487302FNDC5fibronectin type III domain containing 59615VGNC:40931Inparanoid, OMA, EggNOG
Horse100146454FNDC5fibronectin type III domain containing 59796VGNC:50695Inparanoid, OMA, EggNOG
Pig100622587FNDC5fibronectin type III domain containing 59823OMA, EggNOG
OpossumFNDC5fibronectin type III domain containing 5 [Source:HGNC Symbol;Acc:HGNC:20240]13616Inparanoid, OMA, EggNOG
PlatypusFNDC5fibronectin type III domain containing 5 [Source:HGNC Symbol;Acc:HGNC:20240]9258OMA, EggNOG
Chicken419667FNDC5fibronectin type III domain containing 59031CGNC:2603Inparanoid, OMA, EggNOG
Anole lizardFNDC5fibronectin type III domain containing 5 [Source:HGNC Symbol;Acc:HGNC:20240]28377OMA, EggNOG
Zebrafish555635fndc5bfibronectin type III domain containing 5b7955ZDB-GENE-060503-916OMA, EggNOG
Zebrafish795265fndc5afibronectin type III domain containing 5a7955ZDB-GENE-061207-40Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.