🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

KHSRP

DescripciónFar upstream element-binding protein 2

Gene and Protein Information

Gene ID8570
Uniprot Accession IDs Q92945 O00301 Q59EZ9 Q5U4P6 Q9UNT5 Q9UQH5 FUSE-binding protein 2
Ensembl ID ENSP00000381216
Symbol FUBP2 p75 FBP2 KSRP FUBP2
FamilyBelongs to the KHSRP family.
Sequence
MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNWGPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp455640KHSRPKH-type splicing regulatory protein9598VGNC:3629OMA, EggNOG
Macaque702544KHSRPKH-type splicing regulatory protein9544Inparanoid, OMA, EggNOG
Mouse16549KhsrpKH-type splicing regulatory protein10090MGI:1336214Inparanoid, OMA, EggNOG
Rat171137KhsrpKH-type splicing regulatory protein10116RGD:621828Inparanoid, OMA, EggNOG
Dog485022KHSRPKH-type splicing regulatory protein9615VGNC:42340Inparanoid, OMA, EggNOG
Horse100065608KHSRPKH-type splicing regulatory protein9796VGNC:19353Inparanoid, OMA, EggNOG
Cow505564KHSRPKH-type splicing regulatory protein9913VGNC:30545OMA, EggNOG
Pig100516780KHSRPKH-type splicing regulatory protein9823OMA, EggNOG
OpossumKHSRPKH-type splicing regulatory protein [Source:HGNC Symbol;Acc:HGNC:6316]13616Inparanoid, OMA, EggNOG
Anole lizard100558068khsrpKH-type splicing regulatory protein28377Inparanoid, OMA, EggNOG
Xenopus100170586khsrpKH-type splicing regulatory protein8364XB-GENE-493317Inparanoid, OMA, EggNOG
Zebrafish573145khsrpKH-type splicing regulatory protein7955ZDB-GENE-030131-4357Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    serine protease    /    Far upstream element-binding protein 2
protein    /    nucleic acid binding    /    ribonucleoprotein    /    Far upstream element-binding protein 2
protein    /    nucleic acid binding    /    enzyme modulator    /    Far upstream element-binding protein 2
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Far upstream element-binding protein 2
DTO Classes
protein    /    Enzyme    /    Protease    /    Serine protease    /    Far upstream element-binding protein 2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.