Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Far upstream element-binding protein 2 |
|---|
Gene and Protein Information
| Gene ID | 8570 |
|---|---|
| Uniprot Accession IDs | Q92945 O00301 Q59EZ9 Q5U4P6 Q9UNT5 Q9UQH5 FUSE-binding protein 2 |
| Ensembl ID | ENSP00000381216 |
| Symbol | FUBP2 p75 FBP2 KSRP FUBP2 |
| Family | Belongs to the KHSRP family. |
| Sequence | MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNWGPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGNTYPQWQPPAPHDPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 455640 | KHSRP | KH-type splicing regulatory protein | 9598 | VGNC:3629 | OMA, EggNOG |
| Macaque | 702544 | KHSRP | KH-type splicing regulatory protein | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 16549 | Khsrp | KH-type splicing regulatory protein | 10090 | MGI:1336214 | Inparanoid, OMA, EggNOG |
| Rat | 171137 | Khsrp | KH-type splicing regulatory protein | 10116 | RGD:621828 | Inparanoid, OMA, EggNOG |
| Dog | 485022 | KHSRP | KH-type splicing regulatory protein | 9615 | VGNC:42340 | Inparanoid, OMA, EggNOG |
| Horse | 100065608 | KHSRP | KH-type splicing regulatory protein | 9796 | VGNC:19353 | Inparanoid, OMA, EggNOG |
| Cow | 505564 | KHSRP | KH-type splicing regulatory protein | 9913 | VGNC:30545 | OMA, EggNOG |
| Pig | 100516780 | KHSRP | KH-type splicing regulatory protein | 9823 | OMA, EggNOG | |
| Opossum | KHSRP | KH-type splicing regulatory protein [Source:HGNC Symbol;Acc:HGNC:6316] | 13616 | Inparanoid, OMA, EggNOG | ||
| Anole lizard | 100558068 | khsrp | KH-type splicing regulatory protein | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100170586 | khsrp | KH-type splicing regulatory protein | 8364 | XB-GENE-493317 | Inparanoid, OMA, EggNOG |
| Zebrafish | 573145 | khsrp | KH-type splicing regulatory protein | 7955 | ZDB-GENE-030131-4357 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / serine protease / Far upstream element-binding protein 2
protein / nucleic acid binding / ribonucleoprotein / Far upstream element-binding protein 2
protein / nucleic acid binding / enzyme modulator / Far upstream element-binding protein 2
protein / nucleic acid binding / mRNA splicing factor / Far upstream element-binding protein 2
protein / nucleic acid binding / serine protease / Far upstream element-binding protein 2
protein / nucleic acid binding / ribonucleoprotein / Far upstream element-binding protein 2
protein / nucleic acid binding / enzyme modulator / Far upstream element-binding protein 2
protein / nucleic acid binding / mRNA splicing factor / Far upstream element-binding protein 2
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.