🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

FKBP5

DescripciónPeptidyl-prolyl cis-trans isomerase FKBP5

Gene and Protein Information

Gene ID2289
Uniprot Accession IDs Q13451 F5H7R1 Q59EB8 Q5TGM6 PPIase FKBP5
Ensembl ID ENSP00000444810
Symbol AIG6 FKBP51 P54 AIG6 FKBP51 FKBP54 PPIase Ptg-10
Sequence
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse14229Fkbp5FK506 binding protein 510090MGI:104670Inparanoid, OMA
Rat361810Fkbp5FK506 binding protein 510116RGD:1309155Inparanoid, OMA
Dog481759FKBP5FK506 binding protein 59615VGNC:40891Inparanoid, OMA
Horse100053546FKBP5FK506 binding protein 59796VGNC:18052Inparanoid, OMA
Cow535704FKBP5FK506 binding protein 59913VGNC:29024Inparanoid, OMA
Pig100155423FKBP5FK506 binding protein 59823Inparanoid, OMA
Opossum100028545FKBP5FK506 binding protein 513616Inparanoid, OMA
Anole lizard100551895fkbp5FK506 binding protein 528377Inparanoid, OMA
Zebrafish368924fkbp5FK506 binding protein 57955ZDB-GENE-030616-630Inparanoid, OMA
C. elegans180371fkb-6Peptidylprolyl isomerase6239Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.