Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Four and a half LIM domains protein 2 |
|---|
Gene and Protein Information
| Gene ID | 2274 |
|---|---|
| Uniprot Accession IDs | Q14192 Q13229 Q13644 Q2I5I4 Q5TM15 Q9P294 FHL-2 |
| Ensembl ID | ENSP00000386665 |
| Symbol | DRAL SLIM3 DRAL AAG11 FHL-2 SLIM3 SLIM-3 |
| Sequence | MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459469 | FHL2 | four and a half LIM domains 2 | 9598 | VGNC:10648 | OMA, EggNOG |
| Macaque | 713222 | FHL2 | four and a half LIM domains 2 | 9544 | Inparanoid, OMA | |
| Mouse | 14200 | Fhl2 | four and a half LIM domains 2 | 10090 | MGI:1338762 | Inparanoid, OMA |
| Rat | 63839 | Fhl2 | four and a half LIM domains 2 | 10116 | RGD:61963 | Inparanoid, OMA |
| Dog | 474544 | FHL2 | four and a half LIM domains 2 | 9615 | VGNC:40872 | Inparanoid, OMA |
| Horse | 100049947 | FHL2 | four and a half LIM domains 2 | 9796 | VGNC:18035 | Inparanoid, OMA |
| Cow | 510008 | FHL2 | four and a half LIM domains 2 | 9913 | VGNC:29000 | Inparanoid, OMA |
| Opossum | 100014654 | FHL2 | four and a half LIM domains 2 | 13616 | Inparanoid, OMA | |
| Chicken | 418726 | FHL2 | four and a half LIM domains 2 | 9031 | CGNC:12600 | Inparanoid, OMA |
| Anole lizard | 100557288 | fhl2 | four and a half LIM domains 2 | 28377 | Inparanoid, OMA | |
| Xenopus | 100145283 | fhl2 | four and a half LIM domains 2 | 8364 | XB-GENE-969632 | Inparanoid, OMA |
| Zebrafish | 450007 | fhl2b | four and a half LIM domains 2b | 7955 | ZDB-GENE-041010-121 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transcription factor / zinc finger transcription factor / Four and a half LIM domains protein 2
protein / transcription factor / zinc finger transcription factor / Four and a half LIM domains protein 2
DTO Classes
protein / Transcription factor / Zinc finger transcription factor / Four and a half LIM domains protein 2
protein / Transcription factor / Zinc finger transcription factor / Four and a half LIM domains protein 2
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.