🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

FCGRT

DescripciónIgG receptor FcRn large subunit p51

Gene and Protein Information

Gene ID2217
Uniprot Accession IDs P55899 Q5HYM5 Q9HBV7 Q9NZ19 FcRn
Ensembl ID ENSP00000221466
Symbol FCRN FCRN alpha-chain
FamilyBelongs to the immunoglobulin superfamily.
Sequence
MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp456208FCGRTFc fragment of IgG receptor and transporter9598VGNC:7558Inparanoid, OMA, EggNOG
Macaque718859FCGRTFc fragment of IgG receptor and transporter9544Inparanoid, OMA, EggNOG
Mouse14132FcgrtFc receptor, IgG, alpha chain transporter10090MGI:103017Inparanoid, OMA, EggNOG
Rat29558FcgrtFc fragment of IgG receptor and transporter10116RGD:61811Inparanoid, OMA, EggNOG
Dog476414FCGRTFc fragment of IgG receptor and transporter9615VGNC:40803Inparanoid, OMA, EggNOG
Horse100147583FCGRTFc fragment of IgG receptor and transporter9796VGNC:17976Inparanoid, OMA, EggNOG
Cow338062FCGRTFc fragment of IgG receptor and transporter9913VGNC:28934Inparanoid, OMA, EggNOG
Pig397399FCGRTFc fragment of IgG receptor and transporter9823OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.