🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

FCER1G

DescripciónHigh affinity immunoglobulin epsilon receptor subunit gamma

Gene and Protein Information

Gene ID2207
Uniprot Accession IDs P30273 Q5VTW4
Ensembl ID ENSP00000289902
Symbol FCRG
FamilyBelongs to the CD3Z/FCER1G family.
Sequence
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp100612300FCER1GFc fragment of IgE receptor Ig9598VGNC:6818OMA, EggNOG
Macaque720291FCER1GFc fragment of IgE receptor Ig9544Inparanoid, OMA, EggNOG
Mouse14127Fcer1gFc receptor, IgE, high affinity I, gamma polypeptide10090MGI:95496Inparanoid, OMA, EggNOG
Rat25441Fcer1gFc fragment of IgE receptor Ig10116RGD:2599Inparanoid, OMA, EggNOG
Dog403798FCER1GFc fragment of IgE receptor Ig9615VGNC:40802Inparanoid, OMA, EggNOG
Horse100034137FCER1GFc fragment of IgE receptor Ig9796VGNC:17973OMA, EggNOG
Cow282226FCER1GFc fragment of IgE receptor Ig9913VGNC:28931Inparanoid, OMA, EggNOG
Pig397406FCER1GFc fragment of IgE receptor Ig9823Inparanoid, OMA, EggNOG
OpossumFCER1GFc fragment of IgE receptor Ig [Source:HGNC Symbol;Acc:HGNC:3611]13616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.