224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Heat shock protein beta-1 |
|---|
Gene and Protein Information
| Gene ID | 3315 |
|---|---|
| Uniprot Accession IDs | P04792 B2R4N8 Q6FI47 Q96C20 Q96EI7 Q9UC31 Q9UC34 Q9UC35 Q9UC36 HspB1 |
| Ensembl ID | ENSP00000248553 |
| Symbol | HSP27 HSP28 CMT2F HMN2B HSP27 HSP28 Hsp25 SRP27 HS.76067 HEL-S-102 |
| Family | Belongs to the small heat shock protein (HSP20) family. |
| Sequence | MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463488 | HSPB1 | heat shock protein family B (small) member 1 | 9598 | VGNC:7394 | OMA, EggNOG |
| Macaque | 715615 | HSPB1 | heat shock protein family B (small) member 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 15507 | Hspb1 | heat shock protein 1 | 10090 | MGI:96240 | Inparanoid, OMA, EggNOG |
| Rat | 24471 | Hspb1 | heat shock protein family B (small) member 1 | 10116 | RGD:61306 | Inparanoid, OMA, EggNOG |
| Dog | 403979 | HSPB1 | heat shock protein family B (small) member 1 | 9615 | VGNC:53534 | Inparanoid, OMA, EggNOG |
| Horse | 100059763 | HSPB1 | heat shock protein family B (small) member 1 | 9796 | VGNC:51154 | Inparanoid, OMA, EggNOG |
| Cow | 516099 | HSPB1 | heat shock protein family B (small) member 1 | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 493184 | HSPB1 | heat shock protein family B (small) member 1 | 9823 | Inparanoid, EggNOG | |
| Opossum | 100029144 | HSPB1 | heat shock protein family B (small) member 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 396227 | HSPB1 | heat shock protein family B (small) member 1 | 9031 | CGNC:1361 | Inparanoid, OMA, EggNOG |
| Xenopus | 780278 | hspb1 | heat shock protein family B (small) member 1 | 8364 | XB-GENE-480320 | Inparanoid, OMA, EggNOG |
| Zebrafish | 368243 | hspb1 | heat shock protein, alpha-crystallin-related, 1 | 7955 | ZDB-GENE-030326-4 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.