Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Hyaluronan and proteoglycan link protein 1 |
|---|
Gene and Protein Information
| Gene ID | 1404 |
|---|---|
| Uniprot Accession IDs | P10915 B2R9A9 |
| Ensembl ID | ENSP00000274341 |
| Symbol | CRTL1 CRT1 CRTL1 |
| Family | Belongs to the HAPLN family. |
| Sequence | MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461765 | HAPLN1 | hyaluronan and proteoglycan link protein 1 | 9598 | VGNC:4027 | OMA, EggNOG |
| Macaque | 712501 | HAPLN1 | hyaluronan and proteoglycan link protein 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12950 | Hapln1 | hyaluronan and proteoglycan link protein 1 | 10090 | MGI:1337006 | Inparanoid, OMA, EggNOG |
| Rat | 29331 | Hapln1 | hyaluronan and proteoglycan link protein 1 | 10116 | RGD:2412 | Inparanoid, OMA, EggNOG |
| Dog | 488921 | HAPLN1 | hyaluronan and proteoglycan link protein 1 | 9615 | VGNC:41593 | Inparanoid, OMA, EggNOG |
| Horse | 100034208 | HAPLN1 | hyaluronan and proteoglycan link protein 1 | 9796 | VGNC:18691 | Inparanoid, OMA, EggNOG |
| Cow | 281717 | HAPLN1 | hyaluronan and proteoglycan link protein 1 | 9913 | VGNC:29749 | Inparanoid, OMA, EggNOG |
| Pig | 445513 | HAPLN1 | hyaluronan and proteoglycan link protein 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100011753 | HAPLN1 | hyaluronan and proteoglycan link protein 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100077131 | HAPLN1 | hyaluronan and proteoglycan link protein 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 396475 | HAPLN1 | hyaluronan and proteoglycan link protein 1 | 9031 | CGNC:49825 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100555587 | hapln1 | hyaluronan and proteoglycan link protein 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | hapln1 | hyaluronan and proteoglycan link protein 1 [Source:Xenbase;Acc:XB-GENE-6037477] | 8364 | OMA, EggNOG | ||
| Zebrafish | 569074 | hapln1b | hyaluronan and proteoglycan link protein 1b | 7955 | ZDB-GENE-050920-1 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / extracellular matrix protein / extracellular matrix glycoprotein / Hyaluronan and proteoglycan link protein 1
protein / extracellular matrix protein / extracellular matrix glycoprotein / Hyaluronan and proteoglycan link protein 1
DTO Classes
protein / Extracellular structure / Extracellular matrix glycoprotein / Hyaluronan and proteoglycan link protein 1
protein / Extracellular structure / Extracellular matrix glycoprotein / Hyaluronan and proteoglycan link protein 1
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.