Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Heat shock protein beta-8 |
|---|
Gene and Protein Information
| Gene ID | 26353 |
|---|---|
| Uniprot Accession IDs | Q9UJY1 B2R6A6 Q6FIH3 Q9UKS3 HspB8 |
| Ensembl ID | ENSP00000281938 |
| Symbol | CRYAC E2IG1 HSP22 H11 HMN2 CMT2L DHMN2 E2IG1 HMN2A HSP22 |
| Family | Belongs to the small heat shock protein (HSP20) family. |
| Sequence | MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452295 | HSPB8 | heat shock protein family B (small) member 8 | 9598 | VGNC:5424 | OMA, EggNOG |
| Macaque | 574341 | HSPB8 | heat shock protein family B (small) member 8 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 80888 | Hspb8 | heat shock protein 8 | 10090 | MGI:2135756 | Inparanoid, OMA, EggNOG |
| Rat | 113906 | Hspb8 | heat shock protein family B (small) member 8 | 10116 | RGD:71003 | Inparanoid, OMA, EggNOG |
| Dog | 403553 | HSPB8 | heat shock protein family B (small) member 8 | 9615 | VGNC:52935 | Inparanoid, OMA, EggNOG |
| Horse | 100050779 | HSPB8 | heat shock protein family B (small) member 8 | 9796 | VGNC:50941 | Inparanoid, OMA, EggNOG |
| Cow | 539524 | HSPB8 | heat shock protein family B (small) member 8 | 9913 | VGNC:53907 | Inparanoid, OMA, EggNOG |
| Pig | 100155338 | HSPB8 | heat shock protein family B (small) member 8 | 9823 | OMA, EggNOG | |
| Opossum | HSPB8 | heat shock protein family B (small) member 8 [Source:HGNC Symbol;Acc:HGNC:30171] | 13616 | Inparanoid, OMA, EggNOG | ||
| Chicken | 416988 | HSPB8 | heat shock protein family B (small) member 8 | 9031 | CGNC:5578 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559087 | hspb8 | heat shock protein family B (small) member 8 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 448147 | hspb8 | heat shock protein family B (small) member 8 | 8364 | XB-GENE-945643 | Inparanoid, OMA, EggNOG |
| Zebrafish | 791580 | hspb8 | heat shock protein b8 | 7955 | ZDB-GENE-030131-2480 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.