224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Heat shock factor protein 1 |
|---|
Gene and Protein Information
| Gene ID | 3297 |
|---|---|
| Uniprot Accession IDs | Q00613 A8K4L0 A8MW26 Q53XT4 HSF 1 |
| Ensembl ID | ENSP00000431512 |
| Symbol | HSTF1 HSTF1 |
| Family | Belongs to the HSF family. |
| Sequence | MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 714078 | HSF1 | heat shock transcription factor 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 15499 | Hsf1 | heat shock factor 1 | 10090 | MGI:96238 | Inparanoid, OMA, EggNOG |
| Rat | 79245 | Hsf1 | heat shock transcription factor 1 | 10116 | RGD:620913 | Inparanoid, OMA, EggNOG |
| Dog | 475124 | HSF1 | heat shock transcription factor 1 | 9615 | VGNC:41814 | Inparanoid, OMA, EggNOG |
| Horse | 100063350 | HSF1 | heat shock transcription factor 1 | 9796 | VGNC:18892 | Inparanoid, OMA, EggNOG |
| Cow | 506235 | HSF1 | heat shock transcription factor 1 | 9913 | VGNC:29981 | Inparanoid, OMA, EggNOG |
| Pig | 100511321 | HSF1 | heat shock transcription factor 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100015596 | HSF1 | heat shock transcription factor 1 | 13616 | OMA, EggNOG | |
| Anole lizard | 100561400 | hsf1 | heat shock transcription factor 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100489822 | hsf1 | heat shock transcription factor 1 | 8364 | XB-GENE-997145 | Inparanoid, OMA |
| Zebrafish | 58123 | hsf1 | heat shock transcription factor 1 | 7955 | ZDB-GENE-000616-16 | Inparanoid, OMA |
| Fruitfly | 37068 | Hsf | Heat shock factor | 7227 | FBgn0001222 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.