🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

HSPA4

DescripciónHeat shock 70 kDa protein 4

Gene and Protein Information

Gene ID3308
Uniprot Accession IDs P34932 O95756 Q2TAL4 Q9BUK9
Ensembl ID ENSP00000302961
Symbol APG2 RY APG-2 HSPH2 hsp70 hsp70RY HEL-S-5a HS24/P52
FamilyBelongs to the heat shock protein 70 family.
Sequence
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSANASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAVEIVGGATRIPAVKEKISKFFGKELSTTLNADEAVTRGCALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVFSKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDGSSSKVKVKVRVNVHGIFSVSSASLVEVHKSEENEEPMETDQNAKEEEKMQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSKDKKMDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIENEGKMIMQDKLEKERNDAKNAVEEYVYEMRDKLSGEYEKFVSEDDRNSFTLKLEDTENWLYEDGEDQPKQVYVDKLAELKNLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp462060HSPA4heat shock protein family A (Hsp70) member 49598VGNC:6935OMA, EggNOG
Macaque709585HSPA4heat shock protein family A (Hsp70) member 49544Inparanoid, OMA, EggNOG
Mouse15525Hspa4heat shock protein 410090MGI:1342292Inparanoid, OMA, EggNOG
Rat266759Hspa4heat shock protein family A member 410116RGD:628878Inparanoid, OMA, EggNOG
Dog474680HSPA4heat shock protein family A (Hsp70) member 49615VGNC:51724Inparanoid, OMA
Horse100072809HSPA4heat shock protein family A (Hsp70) member 49796Inparanoid, OMA
Cow536558HSPA4heat shock protein family A (Hsp70) member 49913VGNC:52242Inparanoid, OMA, EggNOG
PigHSPA4heat shock protein family A (Hsp70) member 4 [Source:HGNC Symbol;Acc:HGNC:5237]9823Inparanoid, OMA, EggNOG
Opossum100015971HSPA4heat shock protein family A (Hsp70) member 413616Inparanoid, EggNOG
Anole lizard100565489hspa4heat shock protein family A (Hsp70) member 428377Inparanoid, OMA, EggNOG
Xenopus394863hspa4heat shock protein family A (Hsp70) member 48364XB-GENE-952769Inparanoid, OMA, EggNOG
Zebrafish334086hspa4bheat shock protein 4b7955ZDB-GENE-030131-6018Inparanoid, EggNOG
C. elegans176195hsp-110Heat shock protein 1106239OMA, EggNOG
S.cerevisiae852467SSE2adenyl-nucleotide exchange factor SSE24932S000000373OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.