🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

HOXB9

DescripciónHomeobox protein Hox-B9

Gene and Protein Information

Gene ID3219
Uniprot Accession IDs P17482 B2RDB7 Q9H1I1
Ensembl ID ENSP00000309439
Symbol HOX2E HOX2 HOX2E HOX-2.5
FamilyBelongs to the Abd-B homeobox family.
Sequence
MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp749186HOXB9homeobox B99598VGNC:9327OMA, EggNOG
Mouse15417Hoxb9homeobox B910090MGI:96190Inparanoid, OMA, EggNOG
Rat287647Hoxb9homeo box B910116RGD:1306158Inparanoid, OMA, EggNOG
Dog608958HOXB9homeobox B99615VGNC:41755Inparanoid, OMA, EggNOG
Cow783873HOXB9homeobox B99913VGNC:29922Inparanoid, OMA, EggNOG
Opossum100018371HOXB9homeobox B913616Inparanoid, OMA, EggNOG
Platypus100079821HOXB9homeobox B99258Inparanoid, OMA, EggNOG
Chicken771865HOXB9homeobox B99031CGNC:870Inparanoid, OMA, EggNOG
Anole lizard100562490hoxb9homeobox B928377Inparanoid, OMA, EggNOG
Xenopus394474hoxb9homeobox B98364XB-GENE-963094Inparanoid, OMA, EggNOG
Zebrafish30344hoxb9ahomeobox B9a7955ZDB-GENE-990415-109Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.