Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.

Menú

Cuenta

Configuración

Lenguaje

྾

224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

Inicio
Targets(Human)
EIF4E2

EIF4E2

Descripción	Eukaryotic translation initiation factor 4E type 2

Gene and Protein Information

Gene ID	9470
Uniprot Accession IDs	O60573 B8ZZJ9 O75349 eIF-4E type 2
Ensembl ID	ENSP00000258416
Symbol	EIF4EL3 4EHP IF4e 4E-LP h4EHP EIF4EL3
Family	Belongs to the eukaryotic initiation factor 4E family.
Sequence	MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Nombre	NIF	Other Gene ID	Sources
Chimp	460015	EIF4E2	eukaryotic translation initiation factor 4E family member 2	9598	VGNC:370	OMA, EggNOG
Macaque	713487	EIF4E2	eukaryotic translation initiation factor 4E family member 2	9544		Inparanoid, OMA
Mouse	26987	Eif4e2	eukaryotic translation initiation factor 4E member 2	10090	MGI:1914440	Inparanoid, OMA, EggNOG
Rat	363275	Eif4e2	eukaryotic translation initiation factor 4E family member 2	10116	RGD:1307790	Inparanoid, OMA
Dog	610238	EIF4E2	eukaryotic translation initiation factor 4E family member 2	9615		Inparanoid, OMA, EggNOG
Horse	100057254	EIF4E2	eukaryotic translation initiation factor 4E family member 2	9796	VGNC:17504	Inparanoid, OMA, EggNOG
Cow	519920	EIF4E2	eukaryotic translation initiation factor 4E family member 2	9913	VGNC:28410	Inparanoid, OMA, EggNOG
Pig	100101924	EIF4E2	eukaryotic translation initiation factor 4E family member 2	9823		Inparanoid, EggNOG
Opossum	100011562	EIF4E2	eukaryotic translation initiation factor 4E family member 2	13616		Inparanoid, OMA, EggNOG
Chicken	424941	EIF4E2	eukaryotic translation initiation factor 4E family member 2	9031	CGNC:52295	Inparanoid, OMA, EggNOG
Anole lizard	100563485	eif4e2	eukaryotic translation initiation factor 4E family member 2	28377		Inparanoid, OMA, EggNOG
Xenopus	448677	mgc89871	eukaryotic translation initiation factor 4E family member 2	8364	XB-GENE-973579	Inparanoid, OMA, EggNOG
Zebrafish	541523	eif4e2	eukaryotic translation initiation factor 4E family member 2	7955	ZDB-GENE-050327-59	Inparanoid, OMA, EggNOG
C. elegans	180464	ife-4	Eukaryotic translation initiation factor 4E-4	6239		Inparanoid, OMA, EggNOG
Fruitfly	326255	4EHP	eIF4E-Homologous Protein	7227	FBgn0053100	Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein / nucleic acid binding / translation initiation factor / Eukaryotic translation initiation factor 4E type 2

DTO Classes
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation initiation factor / Eukaryotic translation initiation factor 4E type 2

Associated Recombinant Proteins

Nombre	Specification and purity	Expression system	Protein label	Disponibilidad	Mostrar detalles

Associated Antibodies

Nombre	Specifications	Species reactivity	Aplicación	Disponibilidad	Mostrar detalles

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Nombre	Direct Associated Targets	Disease Type	Mondoid

Bibliography

🔙[Back to Target (Human)]

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.

Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.

EIF4E2

Gene and Protein Information

Protein Classes

Associated Recombinant Proteins

Associated Antibodies

Related active small molecules

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Bibliography