🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

IL20RB

DescripciónInterleukin-20 receptor subunit beta

Gene and Protein Information

Gene ID53833
Uniprot Accession IDs Q6UXL0 B4DL40 Q6P438 Q8IYY5 Q8TAJ7 IL-20 receptor subunit beta
Ensembl ID ENSP00000328133
Symbol DIRS1 DIRS1 FNDC6 IL-20R2
FamilyBelongs to the type II cytokine receptor family.
Sequence
MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAFVGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVMSPEELLRAWIS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp742595IL20RBinterleukin 20 receptor subunit beta9598VGNC:1846OMA, EggNOG
Macaque716769IL20RBinterleukin 20 receptor subunit beta9544Inparanoid, OMA, EggNOG
Mouse213208Il20rbinterleukin 20 receptor beta10090MGI:2143266Inparanoid, OMA, EggNOG
Rat501043Il20rbinterleukin 20 receptor subunit beta10116RGD:1566151Inparanoid, OMA, EggNOG
Dog610961IL20RBinterleukin 20 receptor subunit beta9615VGNC:41966Inparanoid, OMA, EggNOG
Horse100066346IL20RBinterleukin 20 receptor subunit beta9796VGNC:19015Inparanoid, OMA, EggNOG
Cow534581IL20RBinterleukin 20 receptor subunit beta9913VGNC:30140Inparanoid, OMA, EggNOG
Pig100620875IL20RBinterleukin 20 receptor subunit beta9823OMA, EggNOG
Opossum100024106IL20RBinterleukin 20 receptor subunit beta13616Inparanoid, OMA, EggNOG
Chicken768437IL20RBinterleukin 20 receptor subunit beta9031CGNC:9943OMA, EggNOG
Anole lizard100553073il20rbinterleukin 20 receptor subunit beta28377Inparanoid, OMA, EggNOG
Zebrafish100174902crfb16cytokine receptor family member B167955ZDB-GENE-071120-9Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    type II cytokine receptor    /    Interleukin-20 receptor subunit beta
protein    /    receptor    /    defense/immunity protein    /    Interleukin-20 receptor subunit beta
protein    /    receptor    /    type I cytokine receptor    /    Interleukin-20 receptor subunit beta
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Type II cytokine receptor    /    Interleukin-20 receptor subunit beta

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.