🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

AK2

DescripciónAdenylate kinase 2, mitochondrial

Gene and Protein Information

Gene ID204
Uniprot Accession IDs P54819 A8K6L1 B4DHH7 B4DL64 Q16856 Q5EB54 Q5TIF7 Q8TCY2 Q8TCY3 AK 2
Ensembl ID ENSP00000346921
Symbol ADK2 ADK2
FamilyBelongs to the adenylate kinase family. AK2 subfamily.
Sequence
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp456723AK2adenylate kinase 29598VGNC:55OMA, EggNOG
Macaque709737AK2adenylate kinase 29544Inparanoid, OMA, EggNOG
Mouse11637Ak2adenylate kinase 210090MGI:87978Inparanoid, OMA, EggNOG
Rat24184Ak2adenylate kinase 210116RGD:2077Inparanoid, OMA
Dog478145AK2adenylate kinase 29615VGNC:37746Inparanoid, OMA, EggNOG
Horse100055706AK2adenylate kinase 29796VGNC:15195Inparanoid, OMA, EggNOG
Cow280716AK2adenylate kinase 29913VGNC:25771Inparanoid, OMA, EggNOG
Opossum100026105AK2adenylate kinase 213616Inparanoid, OMA, EggNOG
Chicken428227AK2adenylate kinase 29031CGNC:2627Inparanoid, OMA, EggNOG
Anole lizard100560801ak2adenylate kinase 228377Inparanoid, OMA, EggNOG
Xenopus448011ak2adenylate kinase 28364XB-GENE-491598Inparanoid, OMA, EggNOG
Zebrafish321793ak2adenylate kinase 27955ZDB-GENE-030131-512Inparanoid, OMA, EggNOG
C. elegans176118let-754Adenylate kinase6239Inparanoid, OMA, EggNOG
Fruitfly37834Adk2Adenylate kinase 27227FBgn0283494Inparanoid, OMA, EggNOG
S.cerevisiae851812ADK1adenylate kinase ADK14932S000002634Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.