🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

MELK

DescripciónMaternal embryonic leucine zipper kinase

Gene and Protein Information

Gene ID9833
Uniprot Accession IDs Q14680 A6P3A7 A6P3A8 B1AMQ6 B7Z1E6 B7Z5M5 B7Z6Q7 B7Z6R8 B7Z6Y0 B7Z7Q1 D3DRP8 F5H0Y0 F5H2R4 F5H689 Q7L3C3 hMELK
Ensembl ID ENSP00000298048
Symbol KIAA0175 HPK38
FamilyBelongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.
Sequence
MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp465095MELKmaternal embryonic leucine zipper kinase9598VGNC:4782OMA, EggNOG
Macaque716875MELKmaternal embryonic leucine zipper kinase9544Inparanoid, OMA, EggNOG
Mouse17279Melkmaternal embryonic leucine zipper kinase10090MGI:106924Inparanoid, OMA, EggNOG
Dog481608MELKmaternal embryonic leucine zipper kinase9615VGNC:51744Inparanoid, OMA, EggNOG
Horse100055291MELKmaternal embryonic leucine zipper kinase9796VGNC:49328Inparanoid, OMA, EggNOG
Cow520088MELKmaternal embryonic leucine zipper kinase9913VGNC:50031Inparanoid, OMA, EggNOG
Pig100519998MELKmaternal embryonic leucine zipper kinase9823Inparanoid, OMA, EggNOG
Opossum100018004MELKmaternal embryonic leucine zipper kinase13616Inparanoid, OMA, EggNOG
Platypus100078125MELKmaternal embryonic leucine zipper kinase9258Inparanoid, OMA, EggNOG
Chicken428391MELKmaternal embryonic leucine zipper kinase9031CGNC:12305OMA, EggNOG
Anole lizard100555349melkmaternal embryonic leucine zipper kinase28377Inparanoid, OMA, EggNOG
Xenopus549144melkmaternal embryonic leucine zipper kinase8364XB-GENE-987654Inparanoid, OMA, EggNOG
Zebrafish30724melkmaternal embryonic leucine zipper kinase7955ZDB-GENE-990603-5Inparanoid, OMA
C. elegans176877pig-1Maternal embryonic leucine zipper kinase6239Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.