224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Cofilin-1 |
|---|
Gene and Protein Information
| Gene ID | 1072 |
|---|---|
| Uniprot Accession IDs | P23528 B3KUQ1 Q53Y87 Q9UCA2 |
| Ensembl ID | ENSP00000432660 |
| Symbol | CFL CFL cofilin HEL-S-15 |
| Family | Belongs to the actin-binding proteins ADF family. |
| Sequence | MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 745772 | CFL1 | cofilin 1 | 9598 | VGNC:6759 | OMA, EggNOG |
| Macaque | 721882 | CFL1 | cofilin 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12631 | Cfl1 | cofilin 1, non-muscle | 10090 | MGI:101757 | Inparanoid, OMA, EggNOG |
| Rat | 29271 | Cfl1 | cofilin 1 | 10116 | RGD:69285 | Inparanoid, OMA, EggNOG |
| Dog | 476022 | CFL1 | cofilin 1 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100057603 | CFL1 | cofilin 1 | 9796 | VGNC:16464 | Inparanoid, OMA, EggNOG |
| Cow | 534553 | CFL1 | cofilin 1 | 9913 | VGNC:27253 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.