🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

METTL14

DescripciónN6-adenosine-methyltransferase non-catalytic subunit

Gene and Protein Information

Gene ID57721
Uniprot Accession IDs Q9HCE5 A6NIG1 Q969V2
Ensembl ID ENSP00000373474
Symbol KIAA1627 hMETTL14
FamilyBelongs to the MT-A70-like family.
Sequence
MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp461454METTL14methyltransferase like 149598VGNC:633OMA, EggNOG
Macaque704667METTL14methyltransferase like 149544Inparanoid, OMA, EggNOG
Mouse210529Mettl14methyltransferase like 1410090MGI:2442926Inparanoid, OMA, EggNOG
Rat295428Mettl14methyltransferase like 1410116RGD:1304822Inparanoid, OMA, EggNOG
Dog487920METTL14methyltransferase like 149615VGNC:43171Inparanoid, OMA, EggNOG
Horse100072440METTL14methyltransferase like 149796VGNC:20120Inparanoid, OMA, EggNOG
Cow531382METTL14methyltransferase like 149913VGNC:31404Inparanoid, OMA, EggNOG
Pig100525761METTL14methyltransferase like 149823OMA, EggNOG
Opossum100012069METTL14methyltransferase like 1413616Inparanoid, OMA, EggNOG
Platypus100081630METTL14methyltransferase like 149258Inparanoid, OMA, EggNOG
Chicken422684METTL14methyltransferase like 149031CGNC:51803Inparanoid, OMA, EggNOG
Anole lizard100567789mettl14methyltransferase like 1428377Inparanoid, OMA, EggNOG
Xenopus493301mettl14methyltransferase like 148364XB-GENE-5813560Inparanoid, OMA, EggNOG
Zebrafish404603mettl14methyltransferase like 147955ZDB-GENE-040426-2328Inparanoid, OMA, EggNOG
Fruitfly34138CG7818CG7818 gene product from transcript CG7818-RA7227FBgn0032016Inparanoid, OMA, EggNOG
S.cerevisiae850303KAR4Kar4p4932S000000560Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.