🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

MTIF3

DescripciónTranslation initiation factor IF-3, mitochondrial

Gene and Protein Information

Gene ID219402
Uniprot Accession IDs Q9H2K0 Q05BL8 Q5W0V0 Q86X68 IF-3(Mt)
Ensembl ID ENSP00000370508
Symbol IF3mt
FamilyBelongs to the IF-3 family.
Sequence
MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp452504MTIF3mitochondrial translational initiation factor 39598VGNC:5081OMA, EggNOG
Macaque710571MTIF3mitochondrial translational initiation factor 39544Inparanoid, OMA, EggNOG
Mouse76366Mtif3mitochondrial translational initiation factor 310090MGI:1923616Inparanoid, OMA, EggNOG
Rat684274Mtif3mitochondrial translational initiation factor 310116RGD:1592673OMA, EggNOG
Dog477328MTIF3mitochondrial translational initiation factor 39615VGNC:43476Inparanoid, OMA, EggNOG
Horse100051262MTIF3mitochondrial translational initiation factor 39796VGNC:20418Inparanoid, OMA, EggNOG
Cow509987MTIF3mitochondrial translational initiation factor 39913VGNC:31734Inparanoid, OMA, EggNOG
Opossum100025012MTIF3mitochondrial translational initiation factor 313616Inparanoid, OMA, EggNOG
Platypus100090314MTIF3mitochondrial translational initiation factor 39258Inparanoid, OMA, EggNOG
Chicken418930MTIF3mitochondrial translational initiation factor 39031CGNC:12842Inparanoid, OMA, EggNOG
Anole lizard100553396mtif3mitochondrial translational initiation factor 328377Inparanoid, OMA, EggNOG
Xenopus780770mtif3mitochondrial translational initiation factor 38364XB-GENE-877152Inparanoid, OMA, EggNOG
Zebrafish325802mtif3mitochondrial translational initiation factor 37955ZDB-GENE-060228-1Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    translation initiation factor    /    Translation initiation factor IF-3, mitochondrial
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    Translation factor    /    Translation initiation factor    /    Translation initiation factor IF-3, mitochondrial

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.