224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Interleukin-9 |
|---|
Gene and Protein Information
| Gene ID | 3578 |
|---|---|
| Uniprot Accession IDs | P15248 IL-9 |
| Ensembl ID | ENSP00000274520 |
| Symbol | P40 HP40 IL-9 |
| Family | Belongs to the IL-7/IL-9 family. |
| Sequence | MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 745517 | IL9 | interleukin 9 | 9598 | VGNC:13518 | OMA, EggNOG |
| Macaque | 712292 | IL9 | interleukin 9 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 16198 | Il9 | interleukin 9 | 10090 | MGI:96563 | Inparanoid, OMA, EggNOG |
| Rat | 116558 | Il9 | interleukin 9 | 10116 | RGD:620049 | Inparanoid, OMA, EggNOG |
| Horse | IL9 | interleukin 9 [Source:HGNC Symbol;Acc:HGNC:6029] | 9796 | OMA, EggNOG | ||
| Cow | 613392 | IL9 | interleukin 9 | 9913 | VGNC:30171 | Inparanoid, OMA, EggNOG |
| Pig | 100144594 | IL9 | interleukin 9 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 103105574 | IL9 | interleukin 9 | 13616 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.