ERCC1

DescripciónDNA excision repair protein ERCC-1

Gene and Protein Information

Gene ID2067
Uniprot Accession IDs P07992 B2RC01 B3KRR0 Q7Z7F5 Q96S40
Ensembl ID ENSP00000013807
Symbol UV20 COFS4 RAD10
FamilyBelongs to the ERCC1/RAD10/SWI10 family.
Sequence
MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp450179ERCC1ERCC excision repair 1, endonuclease non-catalytic subunit9598VGNC:2387Inparanoid, OMA, EggNOG
Macaque574267ERCC1ERCC excision repair 1, endonuclease non-catalytic subunit9544Inparanoid, OMA, EggNOG
Mouse13870Ercc1excision repair cross-complementing rodent repair deficiency, complementation group 110090MGI:95412Inparanoid, OMA, EggNOG
Rat292673Ercc1ERCC excision repair 1, endonuclease non-catalytic subunit10116RGD:1306992Inparanoid, OMA, EggNOG
Dog612282ERCC1ERCC excision repair 1, endonuclease non-catalytic subunit9615VGNC:40441Inparanoid, OMA, EggNOG
Horse100065660ERCC1ERCC excision repair 1, endonuclease non-catalytic subunit9796VGNC:17655Inparanoid, OMA, EggNOG
Cow615637ERCC1ERCC excision repair 1, endonuclease non-catalytic subunit9913VGNC:28568Inparanoid, OMA, EggNOG
OpossumERCC1ERCC excision repair 1, endonuclease non-catalytic subunit [Source:HGNC Symbol;Acc:HGNC:3433]13616Inparanoid, OMA, EggNOG
Platypus100087730ERCC1ERCC excision repair 1, endonuclease non-catalytic subunit9258Inparanoid, EggNOG
Anole lizard100565865ercc1ERCC excision repair 1, endonuclease non-catalytic subunit28377OMA, EggNOG
Xenopus100135224ercc1excision repair cross-complementation group 18364XB-GENE-5895462Inparanoid, EggNOG
Zebrafish100001425ercc1excision repair cross-complementation group 17955ZDB-GENE-040426-2606Inparanoid, EggNOG
C. elegans172867ercc-1ERCC (DNA excision repair protein) homolog6239Inparanoid, EggNOG
Fruitfly36654Ercc1CG10215 gene product from transcript CG10215-RA7227FBgn0028434Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA binding protein    /    DNA excision repair protein ERCC-1
protein    /    nucleic acid binding    /    nuclease    /    DNA excision repair protein ERCC-1
protein    /    nucleic acid binding    /    endodeoxyribonuclease    /    DNA excision repair protein ERCC-1
DTO Classes
protein    /    Enzyme    /    Nuclease    /    Endodeoxyribonuclease    /    DNA excision repair protein ERCC-1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.