YTHDF2

DescripciónYTH domain-containing family protein 2

Gene and Protein Information

Gene ID51441
Uniprot Accession IDs Q9Y5A9 A6NKG4 A8K966 B4E1G7 D3DPM8 Q5VSZ9 Q8TDH0 Q9BUJ5
Ensembl ID ENSP00000362918
Symbol HGRG8 CAHL HGRG8 NY-REN-2
FamilyBelongs to the YTHDF2 family.
Sequence
MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp740305YTHDF2YTH N6-methyladenosine RNA binding protein 29598VGNC:10072OMA, EggNOG
Macaque717225YTHDF2YTH N6-methyladenosine RNA binding protein 29544Inparanoid, OMA, EggNOG
Mouse213541Ythdf2YTH domain family 210090MGI:2444233Inparanoid, OMA, EggNOG
Rat313053Ythdf2YTH N(6)-methyladenosine RNA binding protein 210116RGD:1311321Inparanoid, OMA
Dog478161YTHDF2YTH N6-methyladenosine RNA binding protein 29615VGNC:48506Inparanoid, OMA, EggNOG
Horse100070667YTHDF2YTH N6-methyladenosine RNA binding protein 29796VGNC:25116Inparanoid, OMA, EggNOG
Cow541050YTHDF2YTH N6-methyladenosine RNA binding protein 29913VGNC:37042Inparanoid, OMA, EggNOG
Pig100623159YTHDF2YTH N6-methyladenosine RNA binding protein 29823OMA, EggNOG
Opossum100021047YTHDF2YTH N6-methyladenosine RNA binding protein 213616Inparanoid, OMA, EggNOG
Anole lizard100565737ythdf2YTH N6-methyladenosine RNA binding protein 228377Inparanoid, OMA, EggNOG
Zebrafish393220ythdf2YTH N(6)-methyladenosine RNA binding protein 27955ZDB-GENE-040426-948Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.