🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

ESRRG

DescripciónEstrogen-related receptor gamma

Gene and Protein Information

Gene ID2104
Uniprot Accession IDs P62508 A8K4I0 A8K6I2 B3KY84 E9PGB7 F8W8J3 O75454 O96021 Q68DA0 Q6P274 Q6PK28 Q6TS38 Q9R1F3 Q9UNJ4
Ensembl ID ENSP00000355904
Symbol ERR3 ERRG2 KIAA0832 NR3B3 ERR3 ERRg NR3B3 ERRgamma ERR-gamma
FamilyBelongs to the nuclear hormone receptor family. NR3 subfamily.
Sequence
MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp457738ESRRGestrogen related receptor gamma9598VGNC:6793OMA, EggNOG
Macaque106992350LOC106992350estrogen-related receptor gamma-like9544Inparanoid, OMA, EggNOG
Mouse26381Esrrgestrogen-related receptor gamma10090MGI:1347056Inparanoid, OMA, EggNOG
Rat360896Esrrgestrogen-related receptor gamma10116RGD:1303236Inparanoid, OMA, EggNOG
Dog478961ESRRGestrogen related receptor gamma9615VGNC:40481Inparanoid, OMA, EggNOG
Horse100050530ESRRGestrogen related receptor gamma9796VGNC:17688Inparanoid, OMA, EggNOG
Cow536732ESRRGestrogen related receptor gamma9913VGNC:28610Inparanoid, OMA, EggNOG
Pig100622056ESRRGestrogen related receptor gamma9823OMA, EggNOG
Opossum100023665ESRRGestrogen related receptor gamma13616Inparanoid, OMA, EggNOG
PlatypusESRRGestrogen related receptor gamma [Source:HGNC Symbol;Acc:HGNC:3474]9258OMA, EggNOG
Chicken421357ESRRGestrogen related receptor gamma9031CGNC:51473Inparanoid, OMA
Anole lizard100558650esrrgestrogen related receptor gamma28377Inparanoid, OMA
Xenopus100101684esrrgestrogen related receptor gamma8364XB-GENE-486172Inparanoid, OMA
Zebrafish405890esrrgaestrogen-related receptor gamma a7955ZDB-GENE-030821-2Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.