🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

TOMM20

DescripciónMitochondrial import receptor subunit TOM20 homolog

Gene and Protein Information

Gene ID9804
Uniprot Accession IDs Q15388 A8K195 Q498B3 Q6IBT4
Ensembl ID ENSP00000355566
Symbol KIAA0016 MAS20 MOM19 TOM20
FamilyBelongs to the Tom20 family.
Sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp457833TOMM20translocase of outer mitochondrial membrane 209598VGNC:8554OMA, EggNOG
Mouse67952Tomm20translocase of outer mitochondrial membrane 2010090MGI:1915202Inparanoid, OMA, EggNOG
Rat266601Tomm20translocase of outer mitochondrial membrane 2010116RGD:708467Inparanoid, OMA, EggNOG
Dog100682999TOMM20translocase of outer mitochondrial membrane 209615VGNC:49025Inparanoid, OMA, EggNOG
Horse100058806TOMM20translocase of outer mitochondrial membrane 209796VGNC:49074Inparanoid, OMA, EggNOG
Cow781575TOMM20translocase of outer mitochondrial membrane 209913Inparanoid, OMA, EggNOG
Pig100152814TOMM20translocase of outer mitochondrial membrane 209823Inparanoid, OMA, EggNOG
Opossum100021351TOMM20translocase of outer mitochondrial membrane 2013616Inparanoid, OMA, EggNOG
Anole lizardTOMM20Ltranslocase of outer mitochondrial membrane 20 like [Source:HGNC Symbol;Acc:HGNC:33752]28377Inparanoid, OMA
Xenopus448537tomm20translocase of outer mitochondrial membrane 20 homolog8364XB-GENE-972815Inparanoid, OMA, EggNOG
Zebrafish436971tomm20btranslocase of outer mitochondrial membrane 20b7955ZDB-GENE-040718-451Inparanoid, OMA
C. elegans179691tomm-20Mitochondrial import receptor subunit TOM20 homolog6239Inparanoid, OMA
Fruitfly40189Tom20Translocase of outer membrane 207227FBgn0036928Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.