🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PTP4A3

DescripciónProtein tyrosine phosphatase type IVA 3

Gene and Protein Information

Gene ID11156
Uniprot Accession IDs O75365 Q8IVN5 Q99849 Q9BTW5
Ensembl ID ENSP00000332274
Symbol PRL3 PRL3 PRL-3 PRL-R
FamilyBelongs to the protein-tyrosine phosphatase family.
Sequence
MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp737820PTP4A3protein tyrosine phosphatase type IVA, member 39598VGNC:50317Inparanoid, OMA, EggNOG
Macaque693703PTP4A3protein tyrosine phosphatase type IVA, member 39544Inparanoid, OMA
Mouse19245Ptp4a3protein tyrosine phosphatase 4a310090MGI:1277098Inparanoid, OMA, EggNOG
Rat362930Ptp4a3protein tyrosine phosphatase type IVA, member 310116RGD:1308687Inparanoid, OMA, EggNOG
Dog606961PTP4A3protein tyrosine phosphatase type IVA, member 39615VGNC:45163Inparanoid, OMA, EggNOG
Horse100058296PTP4A3protein tyrosine phosphatase type IVA, member 39796VGNC:22006Inparanoid, OMA, EggNOG
Cow100137722PTP4A3protein tyrosine phosphatase type IVA, member 39913VGNC:33525Inparanoid, OMA, EggNOG
Opossum100032775PTP4A3protein tyrosine phosphatase type IVA, member 313616Inparanoid, OMA, EggNOG
Anole lizard100554421ptp4a3protein tyrosine phosphatase type IVA, member 328377Inparanoid, OMA, EggNOG
Xenopus100216017ptp4a3protein tyrosine phosphatase type IVA, member 38364XB-GENE-943078Inparanoid, OMA
Zebrafish406460ptp4a3protein tyrosine phosphatase type IVA, member 37955ZDB-GENE-040426-2220Inparanoid, OMA, EggNOG
Fruitfly34952PRL-1PRL-1 phosphatase7227FBgn0024734Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.