TPSAB1

DescripciónTryptase alpha/beta-1

Gene and Protein Information

Gene ID7177
Uniprot Accession IDs Q15661 D2E6R9 D2E6S1 P15157 Q15663 Q6B052 Q9H2Y4 Q9H2Y5 Q9UQI1 Tryptase-1
Ensembl ID ENSP00000343577
Symbol TPS1 TPS2 TPSB1 TPS1 TPS2 TPSB1 TPSB2 Tryptase-2
FamilyBelongs to the peptidase S1 family. Tryptase subfamily.
Sequence
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp468084LOC468084tryptase alpha/beta-1-like9598OMA, EggNOG
Macaque699599LOC699599tryptase alpha/beta-19544OMA, EggNOG
Mouse17229Tpsb2tryptase beta 210090MGI:96942OMA, EggNOG
Rat54271Tpsab1tryptase alpha/beta 110116RGD:3066OMA, EggNOG
Horse100033966RETret proto-oncogene9796OMA, EggNOG
Cow786948LOC786948tryptase-2-like9913OMA, EggNOG
Opossum100022090LOC100022090tryptase alpha/beta-1-like13616OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    peptide hormone    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    serine protease    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    protease inhibitor    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    calmodulin    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    annexin    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    receptor    /    Tryptase alpha/beta-1
DTO Classes
protein    /    Enzyme    /    Protease    /    Serine protease    /    Tryptase alpha/beta-1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.