🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

TNFSF9

DescripciónTumor necrosis factor ligand superfamily member 9

Gene and Protein Information

Gene ID8744
Uniprot Accession IDs P41273 Q2M3S2
Ensembl ID ENSP00000245817
Symbol CD137L TNLG5A 4-1BB-L
FamilyBelongs to the tumor necrosis factor family.
Sequence
MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque700588TNFSF9TNF superfamily member 99544Inparanoid, OMA, EggNOG
Mouse21950Tnfsf9tumor necrosis factor (ligand) superfamily, member 910090MGI:1101058Inparanoid, OMA, EggNOG
Rat353218Tnfsf9TNF superfamily member 910116RGD:727974Inparanoid, OMA, EggNOG
Dog476729TNFSF9TNF superfamily member 99615VGNC:47674Inparanoid, OMA, EggNOG
Horse102150292TNFSF9TNF superfamily member 99796VGNC:52031Inparanoid, OMA, EggNOG
Cow521748TNFSF9TNF superfamily member 99913VGNC:36178Inparanoid, OMA, EggNOG
Pig100736831TNFSF9TNF superfamily member 99823OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.