224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Granzyme M |
|---|
Gene and Protein Information
| Gene ID | 3004 |
|---|---|
| Uniprot Accession IDs | P51124 |
| Ensembl ID | ENSP00000264553 |
| Symbol | MET1 MET1 LMET1 |
| Family | Belongs to the peptidase S1 family. Granzyme subfamily. |
| Sequence | MEACVSSLLVLALGALSVGSSFGTQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLARVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSA |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 16904 | Gzmm | granzyme M (lymphocyte met-ase 1) | 10090 | MGI:99549 | Inparanoid, OMA, EggNOG |
| Rat | 29252 | Gzmm | granzyme M | 10116 | RGD:620022 | Inparanoid, OMA, EggNOG |
| Cow | 512272 | GZMM | granzyme M | 9913 | VGNC:29734 | Inparanoid, OMA, EggNOG |
| Opossum | 100024730 | GZMM | granzyme M | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 100859124 | GZMM | granzyme M | 9031 | CGNC:66146 | OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.