PBK

DescripciónLymphokine-activated killer T-cell-originated protein kinase

Gene and Protein Information

Gene ID55872
Uniprot Accession IDs Q96KB5 B4DX68 D3DST2 Q9NPD9 Q9NYL7 Q9NZK6
Ensembl ID ENSP00000428489
Symbol TOPK SPK CT84 TOPK HEL164 Nori-3
FamilyBelongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.
Sequence
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp464496PBKPDZ binding kinase9598VGNC:825OMA, EggNOG
Macaque713242PBKPDZ binding kinase9544Inparanoid, OMA, EggNOG
Mouse52033PbkPDZ binding kinase10090MGI:1289156Inparanoid, OMA, EggNOG
Rat290326PbkPDZ binding kinase10116RGD:1309565Inparanoid, OMA, EggNOG
Dog477371PBKPDZ binding kinase9615Inparanoid, OMA, EggNOG
Horse100060789PBKPDZ binding kinase9796VGNC:21182Inparanoid, OMA, EggNOG
Cow534781PBKPDZ binding kinase9913Inparanoid, OMA, EggNOG
Pig100141310PBKPDZ binding kinase9823Inparanoid, OMA, EggNOG
Platypus100077802PBKPDZ binding kinase9258Inparanoid, OMA, EggNOG
Chicken422003PBKPDZ binding kinase9031CGNC:12423Inparanoid, OMA, EggNOG
Anole lizard100565867pbkPDZ binding kinase28377OMA, EggNOG
Xenopus496810pbkPDZ binding kinase8364XB-GENE-1017083Inparanoid, OMA, EggNOG
Zebrafish360218pbkPDZ binding kinase7955ZDB-GENE-030523-2Inparanoid, OMA, EggNOG
Fruitfly32753CG8173CG8173 gene product from transcript CG8173-RA7227FBgn0030864Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.