SIRT5

DescripciónNAD-dependent protein deacylase sirtuin-5, mitochondrial

Gene and Protein Information

Gene ID23408
Uniprot Accession IDs Q9NXA8 B4DFM4 B4DYJ5 F5H5Z9 Q5T294 Q5T295 Q9Y6E6
Ensembl ID ENSP00000476228
Symbol SIR2L5 SIR2L5
FamilyBelongs to the sirtuin family. Class III subfamily.
Sequence
MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp747069SIRT5sirtuin 59598VGNC:11282OMA, EggNOG
Macaque700855SIRT5sirtuin 59544Inparanoid, OMA, EggNOG
Mouse68346Sirt5sirtuin 510090MGI:1915596Inparanoid, OMA, EggNOG
Rat306840Sirt5sirtuin 510116RGD:1303285Inparanoid, OMA, EggNOG
Dog478726SIRT5sirtuin 59615VGNC:46186Inparanoid, OMA, EggNOG
Horse100051757SIRT5sirtuin 59796VGNC:22990Inparanoid, OMA, EggNOG
Cow507347SIRT5sirtuin 59913VGNC:34634Inparanoid, OMA, EggNOG
OpossumSIRT5NAD-dependent protein deacylase sirtuin-5, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:F7D4X9]13616Inparanoid, OMA, EggNOG
Platypus100084511SIRT5sirtuin 59258Inparanoid, OMA, EggNOG
Chicken420834SIRT5sirtuin 59031CGNC:9629Inparanoid, OMA, EggNOG
Anole lizard100562942sirt5sirtuin 528377Inparanoid, OMA, EggNOG
Xenopus100170199sirt5sirtuin 58364XB-GENE-5892372Inparanoid, OMA, EggNOG
Zebrafish436878sirt5sirtuin 57955ZDB-GENE-040718-349Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    hydrolase    /    deacetylase    /    NAD-dependent protein deacylase sirtuin-5, mitochondrial
protein    /    hydrolase    /    chromatin/chromatin-binding protein    /    NAD-dependent protein deacylase sirtuin-5, mitochondrial
DTO Classes
protein    /    Epigenetic regulator    /    Eraser    /    Histone deacetylase    /    HDAC class III    /    NAD-dependent protein deacylase sirtuin-5, mitochondrial

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.