Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | S-phase kinase-associated protein 1 |
|---|
Gene and Protein Information
| Gene ID | 6500 |
|---|---|
| Uniprot Accession IDs | P63208 D3DQ97 D3DQ98 P34991 Q8TAY2 |
| Ensembl ID | ENSP00000231487 |
| Symbol | EMC19 OCP2 SKP1A TCEB1L OCP2 p19A EMC19 SKP1A OCP-II TCEB1L |
| Family | Belongs to the SKP1 family. |
| Sequence | MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | SKP1 | protein phosphatase 2 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9299] | 9544 | Inparanoid, EggNOG | ||
| Mouse | 21402 | Skp1a | S-phase kinase-associated protein 1A | 10090 | MGI:103575 | Inparanoid, OMA, EggNOG |
| Rat | 287280 | Skp1 | S-phase kinase-associated protein 1 | 10116 | RGD:1359648 | Inparanoid, OMA, EggNOG |
| Dog | 474682 | SKP1 | S-phase kinase associated protein 1 | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100062946 | SKP1 | S-phase kinase associated protein 1 | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 615427 | SKP1 | S-phase kinase associated protein 1 | 9913 | Inparanoid, OMA, EggNOG | |
| Opossum | 100014810 | SKP1 | S-phase kinase associated protein 1 | 13616 | Inparanoid, EggNOG | |
| Chicken | 416319 | SKP1 | S-phase kinase-associated protein 1 | 9031 | CGNC:4880 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100568037 | skp1 | S-phase kinase associated protein 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549273 | skp1 | S-phase kinase-associated protein 1 | 8364 | XB-GENE-919631 | Inparanoid, OMA, EggNOG |
| Zebrafish | 393716 | skp1 | S-phase kinase-associated protein 1 | 7955 | ZDB-GENE-040426-1707 | Inparanoid, OMA, EggNOG |
| C. elegans | 172775 | skr-1 | Skp1-related protein | 6239 | OMA, EggNOG | |
| C. elegans | 172773 | skr-2 | SKp1 Related (ubiquitin ligase complex component) | 6239 | Inparanoid, OMA | |
| Fruitfly | 31016 | SkpA | SKP1-related A | 7227 | FBgn0025637 | Inparanoid, EggNOG |
| S.cerevisiae | 851928 | SKP1 | SCF ubiquitin ligase subunit SKP1 | 4932 | S000002736 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / Enzyme / Ligase / Ubiquitin-protein ligase / S-phase kinase-associated protein 1
protein / Enzyme / Ligase / Ubiquitin-protein ligase / S-phase kinase-associated protein 1
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.