Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Elongation of very long chain fatty acids protein 5 |
|---|
Gene and Protein Information
| Gene ID | 60481 |
|---|---|
| Uniprot Accession IDs | Q9NYP7 B4DZJ2 F6SH78 Q59EL3 Q5TGH5 Q6NXE7 Q7L2S5 Q8NCG4 Q9UI22 |
| Ensembl ID | ENSP00000359956 |
| Symbol | ELOVL2 HELO1 SCA38 dJ483K16.1 |
| Family | Belongs to the ELO family. ELOVL5 subfamily. |
| Sequence | MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 712243 | ELOVL5 | ELOVL fatty acid elongase 5 | 9544 | Inparanoid, OMA | |
| Mouse | 68801 | Elovl5 | ELOVL family member 5, elongation of long chain fatty acids (yeast) | 10090 | MGI:1916051 | Inparanoid, OMA |
| Rat | 171400 | Elovl5 | ELOVL fatty acid elongase 5 | 10116 | RGD:620583 | Inparanoid, OMA |
| Dog | 610377 | ELOVL5 | ELOVL fatty acid elongase 5 | 9615 | VGNC:40323 | Inparanoid, OMA |
| Horse | 100069400 | ELOVL5 | ELOVL fatty acid elongase 5 | 9796 | VGNC:17541 | Inparanoid, OMA |
| Cow | 617293 | ELOVL5 | ELOVL fatty acid elongase 5 | 9913 | VGNC:28451 | Inparanoid, OMA |
| Opossum | 100014197 | ELOVL5 | ELOVL fatty acid elongase 5 | 13616 | Inparanoid, OMA | |
| Platypus | 100089631 | ELOVL5 | ELOVL fatty acid elongase 5 | 9258 | Inparanoid, OMA | |
| Chicken | 428646 | ELOVL5 | ELOVL fatty acid elongase 5 | 9031 | CGNC:12203 | Inparanoid, OMA |
| Anole lizard | 100552106 | elovl5 | ELOVL fatty acid elongase 5 | 28377 | Inparanoid, OMA | |
| Xenopus | 496694 | elovl5 | ELOVL fatty acid elongase 5 | 8364 | XB-GENE-952346 | Inparanoid, OMA |
| Zebrafish | 393425 | elovl5 | ELOVL fatty acid elongase 5 | 7955 | ZDB-GENE-040407-2 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transferase / acyltransferase / Elongation of very long chain fatty acids protein 5
protein / transferase / acyltransferase / Elongation of very long chain fatty acids protein 5
DTO Classes
protein / Enzyme / Transferase / Acyltransferase / Elongation of very long chain fatty acids protein 5
protein / Enzyme / Transferase / Acyltransferase / Elongation of very long chain fatty acids protein 5
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.