224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Serpin B8 |
|---|
Gene and Protein Information
| Gene ID | 5271 |
|---|---|
| Uniprot Accession IDs | P50452 B4DTW2 Q7Z2V6 Q8N178 |
| Ensembl ID | ENSP00000381072 |
| Symbol | PI8 PI8 CAP2 PI-8 PSS5 C18orf53 |
| Family | Belongs to the serpin family. Ov-serpin subfamily. |
| Sequence | MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCADHPFLFFIRHHKTNCILFCGRFSSP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 107969517 | SERPINB8 | serpin family B member 8 | 9598 | VGNC:9947 | OMA, EggNOG |
| Macaque | 100424017 | LOC100424017 | serpin B8 | 9544 | OMA, EggNOG | |
| Mouse | 20725 | Serpinb8 | serine (or cysteine) peptidase inhibitor, clade B, member 8 | 10090 | MGI:894657 | Inparanoid, OMA, EggNOG |
| Rat | 288937 | Serpinb8 | serpin family B member 8 | 10116 | RGD:1309833 | Inparanoid, OMA, EggNOG |
| Dog | 607205 | SERPINB8 | serpin family B member 8 | 9615 | VGNC:53976 | Inparanoid, OMA |
| Horse | 100051655 | SERPINB8 | serpin family B member 8 | 9796 | VGNC:22852 | Inparanoid, OMA |
| Cow | 513825 | SERPINB8 | serpin peptidase inhibitor, clade B (ovalbumin), member 8 | 9913 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.