🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

NAPG

DescripciónGamma-soluble NSF attachment protein

Gene and Protein Information

Gene ID8774
Uniprot Accession IDs Q99747 B4DFC9 Q9BUV1 SNAP-gamma
Ensembl ID ENSP00000324628
Symbol SNAPG GAMMASNAP
FamilyBelongs to the SNAP family.
Sequence
MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp468475NAPGNSF attachment protein gamma9598VGNC:7326OMA, EggNOG
Mouse108123NapgN-ethylmaleimide sensitive fusion protein attachment protein gamma10090MGI:104561Inparanoid, OMA, EggNOG
Rat307382NapgNSF attachment protein gamma10116RGD:1310109Inparanoid, OMA
Dog608647NAPGNSF attachment protein gamma9615VGNC:43622Inparanoid, OMA, EggNOG
Horse100050057NAPGNSF attachment protein gamma9796VGNC:20562Inparanoid, OMA, EggNOG
Cow509041NAPGNSF attachment protein gamma9913VGNC:31884Inparanoid, OMA, EggNOG
Opossum100013513NAPGNSF attachment protein gamma13616Inparanoid, OMA, EggNOG
Platypus100074713NAPGNSF attachment protein gamma9258Inparanoid, OMA, EggNOG
Chicken421051NAPGNSF attachment protein gamma9031CGNC:51393Inparanoid, OMA, EggNOG
Anole lizard100556211napgNSF attachment protein gamma28377Inparanoid, OMA, EggNOG
Xenopus100135361napgN-ethylmaleimide-sensitive factor attachment protein, gamma8364XB-GENE-967831Inparanoid, OMA, EggNOG
Zebrafish541353napgaN-ethylmaleimide-sensitive factor attachment protein, gamma a7955ZDB-GENE-050320-46OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.