Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Torsin-4A |
|---|
Gene and Protein Information
| Gene ID | 54863 |
|---|---|
| Uniprot Accession IDs | Q9NXH8 A2BFA4 |
| Ensembl ID | ENSP00000350102 |
| Symbol | C9orf167 C9orf167 |
| Family | Belongs to the ClpA/ClpB family. Torsin subfamily. |
| Sequence | MDRGQPSLEPAAAAPRASGRCVIAPVRAVLRLRRRVCVLRKRRLLQPGGGPDVGTGAPRPGCSPRAPRADLDQPKFFTFDSPAELPSRTPRKKRRRSRLVLYPETSRKYRPRVEHRSRAQRCLLLLVAIVGFQVLNAIENLDDNAQRYDLDGLEKALQRAVFGQPAAVSRIVALMRDYLATHVHSRPLLLALHGPSGVGKSHVGRLLARHFRSVLEDSALVLQYHARHHCPEARAAQDCREELARRVADVVARAEAEEKTPLLVLDDVELMPRPLLDELHGFLQPQRSHHFHNAIYVLLSGAGGAEVTRFVLQNASRALPLRPDGFRSAEAAAAQAEEDLRASLLAVLSREHPLWQAAAIVPFLLLDKRDVVSCFRDEMAGEGFFPDQARAENLAAQLSFYRVAGREFAVTGCKQVVATVNLL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 704865 | TOR4A | torsin family 4 member A | 9544 | OMA, EggNOG | |
| Mouse | 227612 | Tor4a | torsin family 4, member A | 10090 | MGI:2442720 | Inparanoid, OMA, EggNOG |
| Rat | 311795 | Tor4a | torsin family 4, member A | 10116 | RGD:1308019 | Inparanoid, OMA, EggNOG |
| Dog | 491229 | TOR4A | torsin family 4 member A | 9615 | VGNC:47716 | Inparanoid, OMA, EggNOG |
| Horse | TOR4A | torsin family 4 member A [Source:HGNC Symbol;Acc:HGNC:25981] | 9796 | OMA, EggNOG | ||
| Cow | 618444 | TOR4A | torsin family 4 member A | 9913 | VGNC:36227 | OMA, EggNOG |
| Pig | 100514387 | TOR4A | torsin family 4 member A | 9823 | OMA, EggNOG | |
| Opossum | 103095994 | TOR4A | torsin family 4 member A | 13616 | Inparanoid, EggNOG | |
| Platypus | TOR4A | torsin family 4 member A [Source:HGNC Symbol;Acc:HGNC:25981] | 9258 | OMA, EggNOG | ||
| Chicken | 417257 | TOR4A | torsin family 4 member A | 9031 | CGNC:6546 | OMA, EggNOG |
| Anole lizard | 100556226 | tor4a | torsin family 4 member A | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 594988 | tor4a | torsin family 4, member A | 8364 | XB-GENE-975360 | Inparanoid, OMA, EggNOG |
| Zebrafish | 550133 | tor4aa | torsin family 4, member Aa | 7955 | ZDB-GENE-050417-9 | OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.