🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

SOD2

DescripciónSuperoxide dismutase [Mn], mitochondrial

Gene and Protein Information

Gene ID6648
Uniprot Accession IDs P04179 B2R7R1 B3KUK2 B4DL20 B4E3K9 E1P5A9 P78434 Q16792 Q5TCM1 Q96EE6 Q9P2Z3
Ensembl ID ENSP00000446252
Symbol IPOB IPO-B MNSOD MVCD6 Mn-SOD
FamilyBelongs to the iron/manganese superoxide dismutase family.
Sequence
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp449634SOD2superoxide dismutase 29598VGNC:52105Inparanoid, OMA, EggNOG
Macaque574097SOD2superoxide dismutase 29544Inparanoid, EggNOG
Mouse20656Sod2superoxide dismutase 2, mitochondrial10090MGI:98352Inparanoid, OMA, EggNOG
Rat24787Sod2superoxide dismutase 210116RGD:3732Inparanoid, OMA, EggNOG
Dog476258SOD2superoxide dismutase 29615VGNC:53988OMA, EggNOG
Horse100034223SOD2superoxide dismutase 29796Inparanoid, OMA, EggNOG
Cow281496SOD2superoxide dismutase 2, mitochondrial9913Inparanoid, EggNOG
Opossum100032426SOD2superoxide dismutase 213616Inparanoid, OMA, EggNOG
Chicken374042SOD2superoxide dismutase 2, mitochondrial9031CGNC:8863Inparanoid, OMA, EggNOG
Anole lizard100556234sod2superoxide dismutase 228377Inparanoid, OMA, EggNOG
Xenopus448200sod2superoxide dismutase 28364XB-GENE-1000989Inparanoid, OMA, EggNOG
Zebrafish335799sod2superoxide dismutase 2, mitochondrial7955ZDB-GENE-030131-7742Inparanoid, OMA, EggNOG
C. elegans172632sod-2Superoxide dismutase [Mn] 1, mitochondrial6239OMA, EggNOG
C. elegans181748sod-3Superoxide dismutase [Mn] 2, mitochondrial6239Inparanoid, OMA
Fruitfly36878Sod2Superoxide dismutase 2 (Mn)7227FBgn0010213Inparanoid, EggNOG
S.cerevisiae856399SOD2superoxide dismutase SOD24932S000001050Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.