Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Tumor necrosis factor ligand superfamily member 4 |
|---|
Gene and Protein Information
| Gene ID | 7292 |
|---|---|
| Uniprot Accession IDs | P23510 Q5JZA5 Q8IV74 Q9HCN9 |
| Ensembl ID | ENSP00000281834 |
| Symbol | TXGP1 GP34 CD252 OX4OL TXGP1 CD134L OX-40L TNLG2B |
| Family | Belongs to the tumor necrosis factor family. |
| Sequence | MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469586 | TNFSF4 | TNF superfamily member 4 | 9598 | VGNC:7014 | OMA, EggNOG |
| Macaque | 706255 | TNFSF4 | TNF superfamily member 4 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 22164 | Tnfsf4 | tumor necrosis factor (ligand) superfamily, member 4 | 10090 | MGI:104511 | Inparanoid, OMA, EggNOG |
| Rat | 89814 | Tnfsf4 | TNF superfamily member 4 | 10116 | RGD:619816 | Inparanoid, OMA, EggNOG |
| Dog | 100855878 | TNFSF4 | TNF superfamily member 4 | 9615 | VGNC:47672 | Inparanoid, OMA, EggNOG |
| Horse | 100060605 | TNFSF4 | TNF superfamily member 4 | 9796 | VGNC:24379 | Inparanoid, OMA, EggNOG |
| Cow | 539800 | TNFSF4 | TNF superfamily member 4 | 9913 | VGNC:36176 | Inparanoid, OMA, EggNOG |
| Pig | 574053 | TNFSF4 | TNF superfamily member 4 | 9823 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / signaling molecule / tumor necrosis factor family member / Tumor necrosis factor ligand superfamily member 4
protein / signaling molecule / tumor necrosis factor family member / Tumor necrosis factor ligand superfamily member 4
DTO Classes
protein / Signaling / Cytokine / Tumor necrosis factor family member / Tumor necrosis factor ligand superfamily member 4
protein / Signaling / Cytokine / Tumor necrosis factor family member / Tumor necrosis factor ligand superfamily member 4
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.