224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Mothers against decapentaplegic homolog 1 |
|---|
Gene and Protein Information
| Gene ID | 4086 |
|---|---|
| Uniprot Accession IDs | Q15797 A8KAJ0 D3DNZ9 Q16636 Q9UFT8 MAD homolog 1 |
| Ensembl ID | ENSP00000426568 |
| Symbol | BSP1 MADH1 MADR1 BSP1 JV41 BSP-1 JV4-1 MADH1 MADR1 |
| Family | Belongs to the dwarfin/SMAD family. |
| Sequence | MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 574340 | SMAD1 | SMAD family member 1 | 9544 | Inparanoid, OMA | |
| Mouse | 17125 | Smad1 | SMAD family member 1 | 10090 | MGI:109452 | Inparanoid, OMA |
| Rat | 25671 | Smad1 | SMAD family member 1 | 10116 | RGD:3030 | Inparanoid, OMA |
| Dog | 475456 | SMAD1 | SMAD family member 1 | 9615 | VGNC:46518 | Inparanoid, OMA |
| Horse | 100033850 | SMAD1 | SMAD family member 1 | 9796 | VGNC:23310 | Inparanoid, OMA |
| Cow | 540488 | SMAD1 | SMAD family member 1 | 9913 | VGNC:34974 | Inparanoid, OMA |
| Opossum | 100018882 | SMAD1 | SMAD family member 1 | 13616 | Inparanoid, OMA | |
| Platypus | 100079987 | SMAD1 | SMAD family member 1 | 9258 | Inparanoid, OMA | |
| Chicken | 395680 | SMAD1 | SMAD family member 1 | 9031 | CGNC:7584 | Inparanoid, OMA |
| Anole lizard | 100556712 | smad1 | SMAD family member 1 | 28377 | Inparanoid, OMA | |
| Xenopus | 493211 | smad1 | SMAD family member 1 | 8364 | XB-GENE-1018193 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.