Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Survival motor neuron protein |
|---|
Gene and Protein Information
| Gene ID | 6606 |
|---|---|
| Uniprot Accession IDs | Q16637 A8K0V4 Q13119 Q549U5 Q96J51 |
| Ensembl ID | ENSP00000370119 |
| Symbol | SMN SMNT SMA SMN SMA1 SMA2 SMA3 SMA4 SMA@ SMNT BCD541 GEMIN1 TDRD16A T-BCD541 |
| Family | Belongs to the SMN family. |
| Sequence | MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461829 | LOC461829 | survival motor neuron protein | 9598 | OMA, EggNOG | |
| Macaque | 677703 | SMN1 | survival of motor neuron 1, telomeric | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20595 | Smn1 | survival motor neuron 1 | 10090 | MGI:109257 | Inparanoid, OMA, EggNOG |
| Rat | 64301 | Smn1 | survival of motor neuron 1, telomeric | 10116 | RGD:620755 | Inparanoid, OMA, EggNOG |
| Dog | 403896 | SMN | survival motor neuron | 9615 | OMA, EggNOG | |
| Horse | 100065744 | LOC100065744 | survival motor neuron protein | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 281492 | SMN2 | survival of motor neuron 2, centromeric | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100170853 | SMN1 | survival of motor neuron 1, telomeric | 9823 | OMA, EggNOG | |
| Opossum | 100011364 | LOC100011364 | survival motor neuron protein | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100081724 | LOC100081724 | survival of motor neuron protein | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 374025 | SMN | survival of motor neuron | 9031 | CGNC:49008 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100553231 | LOC100553231 | survival of motor neuron protein | 28377 | OMA, EggNOG | |
| Xenopus | 100101724 | smn2 | survival of motor neuron 2, centromeric | 8364 | XB-GENE-489160 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30432 | smn1 | survival of motor neuron 1, telomeric | 7955 | ZDB-GENE-990715-16 | Inparanoid, OMA, EggNOG |
| C. elegans | 172783 | smn-1 | SMN (human Survival Motor Neuron gene) homolog | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 39844 | Smn | survival motor neuron | 7227 | FBgn0036641 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / Epigenetic regulator / Reader / Methyl-lysine/arginine binding protein / Tudor domain / Survival motor neuron protein
protein / Epigenetic regulator / Reader / Methyl-lysine/arginine binding protein / Tudor domain / Survival motor neuron protein
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.