🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

ERP29

DescripciónEndoplasmic reticulum resident protein 29

Gene and Protein Information

Gene ID10961
Uniprot Accession IDs P30040 C9J183 Q3MJC3 Q6FHT4 ERp29
Ensembl ID ENSP00000261735
Symbol C12orf8 ERP28 ERp28 ERp31 PDIA9 PDI-DB C12orf8 HEL-S-107
Sequence
MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp738376ERP29endoplasmic reticulum protein 299598VGNC:5368OMA, EggNOG
Mouse67397Erp29endoplasmic reticulum protein 2910090MGI:1914647Inparanoid, OMA, EggNOG
Rat117030Erp29endoplasmic reticulum protein 2910116RGD:619781Inparanoid, OMA, EggNOG
Dog477482ERP29endoplasmic reticulum protein 299615VGNC:40468Inparanoid, OMA, EggNOG
Horse100057258ERP29endoplasmic reticulum protein 299796VGNC:17675Inparanoid, OMA, EggNOG
Cow613357ERP29endoplasmic reticulum protein 299913VGNC:28596Inparanoid, OMA, EggNOG
Pig100156625ERP29endoplasmic reticulum protein 299823Inparanoid, OMA, EggNOG
OpossumERP29endoplasmic reticulum protein 29 [Source:HGNC Symbol;Acc:HGNC:13799]13616Inparanoid, OMA, EggNOG
Platypus100074933ERP29endoplasmic reticulum protein 299258Inparanoid, OMA, EggNOG
Chicken416882ERP29endoplasmic reticulum protein 299031CGNC:50366OMA, EggNOG
Anole lizard100558558erp29endoplasmic reticulum protein 2928377Inparanoid, OMA, EggNOG
Xenopuserp29endoplasmic reticulum protein 29 [Source:Xenbase;Acc:XB-GENE-6045950]8364OMA, EggNOG
Fruitfly37206wblwindbeutel7227FBgn0004003Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.