224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Sorting nexin-5 |
|---|
Gene and Protein Information
| Gene ID | 27131 |
|---|---|
| Uniprot Accession IDs | Q9Y5X3 B7ZKN3 D3DW26 Q52LC4 Q7KZN0 Q9BWP0 |
| Ensembl ID | ENSP00000366998 |
| Family | Belongs to the sorting nexin family. |
| Sequence | MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458110 | SNX5 | sorting nexin 5 | 9598 | VGNC:6268 | OMA, EggNOG |
| Macaque | 698897 | SNX5 | sorting nexin 5 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 69178 | Snx5 | sorting nexin 5 | 10090 | MGI:1916428 | Inparanoid, OMA, EggNOG |
| Rat | 296199 | Snx5 | sorting nexin 5 | 10116 | RGD:1310190 | Inparanoid, OMA, EggNOG |
| Dog | 100855895 | SNX5 | sorting nexin 5 | 9615 | VGNC:46642 | Inparanoid, OMA, EggNOG |
| Horse | 100062401 | SNX5 | sorting nexin 5 | 9796 | VGNC:23431 | Inparanoid, OMA, EggNOG |
| Cow | 514423 | SNX5 | sorting nexin 5 | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100155390 | SNX5 | sorting nexin 5 | 9823 | OMA, EggNOG | |
| Opossum | 100033258 | SNX5 | sorting nexin 5 | 13616 | Inparanoid, EggNOG | |
| Platypus | SNX5 | sorting nexin 5 [Source:HGNC Symbol;Acc:HGNC:14969] | 9258 | OMA, EggNOG | ||
| Chicken | 416718 | SNX5 | sorting nexin 5 | 9031 | CGNC:50332 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556706 | snx5 | sorting nexin 5 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 548835 | snx5 | sorting nexin 5 | 8364 | XB-GENE-947018 | Inparanoid, OMA, EggNOG |
| Zebrafish | 406797 | snx5 | sorting nexin 5 | 7955 | ZDB-GENE-040426-2857 | Inparanoid, OMA, EggNOG |
| C. elegans | 190399 | snx-6 | Sorting NeXin | 6239 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.