🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

GPR3

DescripciónG-protein coupled receptor 3

Gene and Protein Information

Gene ID2827
Uniprot Accession IDs P46089 A8K570
Ensembl ID ENSP00000363136
Symbol ACCA ACCA
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque716033GPR3G protein-coupled receptor 39544Inparanoid, OMA, EggNOG
Mouse14748Gpr3G-protein coupled receptor 310090MGI:101908Inparanoid, OMA, EggNOG
Rat266769Gpr3G protein-coupled receptor 310116RGD:628686Inparanoid, OMA
Dog487344GPR3G protein-coupled receptor 39615VGNC:41429Inparanoid, OMA
Horse100070910GPR3G protein-coupled receptor 39796VGNC:18538Inparanoid, OMA
Cow540687GPR3G protein-coupled receptor 39913VGNC:29581Inparanoid, OMA
Pig100512611GPR3G protein-coupled receptor 39823Inparanoid, OMA
Anole lizard100552746gpr3G protein-coupled receptor 328377Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    G-protein coupled receptor 3
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    G-protein coupled receptor 3

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.