224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Sphingosine 1-phosphate receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 1901 |
|---|---|
| Uniprot Accession IDs | P21453 D3DT66 Q9BYY4 Q9NYN8 S1P receptor 1 |
| Ensembl ID | ENSP00000305416 |
| Symbol | CHEDG1 EDG1 EDG1 S1P1 CD363 ECGF1 EDG-1 CHEDG1 D1S3362 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457063 | S1PR1 | sphingosine-1-phosphate receptor 1 | 9598 | VGNC:8100 | OMA, EggNOG |
| Mouse | 13609 | S1pr1 | sphingosine-1-phosphate receptor 1 | 10090 | MGI:1096355 | Inparanoid, OMA, EggNOG |
| Rat | 29733 | S1pr1 | sphingosine-1-phosphate receptor 1 | 10116 | RGD:61958 | Inparanoid, OMA, EggNOG |
| Dog | 490138 | S1PR1 | sphingosine-1-phosphate receptor 1 | 9615 | VGNC:45836 | Inparanoid, OMA |
| Horse | 100050049 | S1PR1 | sphingosine-1-phosphate receptor 1 | 9796 | VGNC:22660 | Inparanoid, OMA, EggNOG |
| Cow | 281135 | S1PR1 | sphingosine-1-phosphate receptor 1 | 9913 | VGNC:34252 | Inparanoid, OMA, EggNOG |
| Pig | 100621202 | S1PR1 | sphingosine-1-phosphate receptor 1 | 9823 | OMA, EggNOG | |
| Opossum | 100032972 | S1PR1 | sphingosine-1-phosphate receptor 1 | 13616 | Inparanoid, OMA | |
| Platypus | S1PR1 | sphingosine-1-phosphate receptor 1 [Source:HGNC Symbol;Acc:HGNC:3165] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100557814 | LOC100557814 | uncharacterized oxidoreductase ZK1290.5 | 28377 | Inparanoid, OMA | |
| Xenopus | 780355 | s1pr1 | sphingosine-1-phosphate receptor 1 | 8364 | XB-GENE-977003 | Inparanoid, OMA, EggNOG |
| Zebrafish | 64617 | s1pr1 | sphingosine-1-phosphate receptor 1 | 7955 | ZDB-GENE-001228-2 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / Sphingosine 1-phosphate receptor 1
protein / receptor / G-protein coupled receptor / Sphingosine 1-phosphate receptor 1
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Sphingosine 1-phosphate receptor 1
protein / G-protein coupled receptor / Class A rhodopsin like / Sphingosine 1-phosphate receptor 1
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.